PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast05G168300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 689aa    MW: 75476.1 Da    PI: 4.2467
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast05G168300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM145.72.5e-4591342128
                 NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                         ppGfrF+Ptdeelv ++Lk+++++ + +    i++vd+yk++P++Lp+  ++++++k+w+f s+ d+ky++g+r++r+t++gyWkatgkd+
  Brast05G168300.1.p   9 PPGFRFSPTDEELVLYFLKRRIASGRPTP--YIADVDVYKSHPSHLPErsALRTGDKQWFFCSRLDRKYPNGSRASRTTAEGYWKATGKDR 97 
                         8*********************9999555..6**************94357788999********************************** PP

                 NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +v++ +g++vg kktLv+++grap+g +tdWvmhey++
  Brast05G168300.1.p  98 TVCN-GGRAVGNKKTLVYHHGRAPRGDRTDWVMHEYTI 134
                         ***9.9******************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-516157IPR003441NAC domain
PROSITE profilePS5100549.9888157IPR003441NAC domain
PfamPF023654.8E-239134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 689 aa     Download sequence    Send to blast
MENPPPRWPP GFRFSPTDEE LVLYFLKRRI ASGRPTPYIA DVDVYKSHPS HLPERSALRT  60
GDKQWFFCSR LDRKYPNGSR ASRTTAEGYW KATGKDRTVC NGGRAVGNKK TLVYHHGRAP  120
RGDRTDWVMH EYTILGDALP PPAQGREGYA LYKLFQKSGV GPKNGEQYGA PFREEDWLDD  180
DEGELQLPVE AADPIPPTVA SDGAMTVDEQ IGDLEALLLQ TGNDQRNIGP PSDSTPVPSQ  240
VLFQHGQSQG WPNDEDNTSE VADATTSSRA MLVEENTCTE LPFGDLEGLL MEISDEQQSA  300
ELFPEFSNPV PQLQLQHDDQ EAWLNADMEE VSVADYTTSS GVVETAECTG RELPYGDLEG  360
LLLQIENDQE NVEPLTDISS PVSHHECHQV GVGDLQRFHG AMFSSVDPSS AVQGSTDFDP  420
QLEPSNQIAQ SALTCMPLSW EANCTEETSV MQSVSGLASY DGQDAHEEFL EINDFFDLED  480
MGQSMNCTTT EHLISSSSGM FDSLEYSDAS MFLPGSFDTA GVVTQNQYID FGDSGYKSQG  540
FQYTAELWAH NQVALNMQNH MKHNHVGLSS HASGTANNIV NEEQLNRSPN TSQSWFNSAL  600
STLLDAVPAS PALAAESNVL NRTLQRISSF RSEQVSNESS APVIHVRRGG ALISISLLVL  660
LAAILWTLAT ASGSAIKFCK GLWQSSST*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-42913416140Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00179DAPTransfer from AT1G34190Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003578349.10.0PREDICTED: NAC domain-containing protein 17-like
TrEMBLI1IRD40.0I1IRD4_BRADI; Uncharacterized protein
STRINGBRADI4G34022.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP91282840
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-63NAC domain containing protein 17